PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_26514A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 266aa    MW: 28779.4 Da    PI: 5.0642
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_26514AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.5e-13242848
                               HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               Ed++lv +++++G g+W + +++ g++R++k+c++rw++yl
  Oropetium_20150105_26514A  2 EDDILVSYIRKHGEGRWGSLPKRAGLKRCGKSCRLRWLNYL 42
                               9**************************************97 PP

2Myb_DNA-binding521.6e-164892147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
  Oropetium_20150105_26514A 48 RGNISDDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 92
                               7899******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.1E-5144IPR001005SANT/Myb domain
PROSITE profilePS5129413.056142IPR017930Myb domain
PfamPF002491.7E-11242IPR001005SANT/Myb domain
CDDcd001677.37E-9242No hitNo description
SuperFamilySSF466891.49E-23289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-19249IPR009057Homeodomain-like
PROSITE profilePS5129425.0164397IPR017930Myb domain
SMARTSM007172.4E-154795IPR001005SANT/Myb domain
PfamPF002492.8E-144892IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-235097IPR009057Homeodomain-like
CDDcd001671.96E-125293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEDDILVSYI RKHGEGRWGS LPKRAGLKRC GKSCRLRWLN YLRPGIKRGN ISDDEEELIV  60
RLHRLLGNRW SLIAGRLPGR TDNEIKNYWN TTLAKKVRGE AMISRSNSKQ QHRASTAAPP  120
ILLRSRPSSE PGKPAGDAAP DEAAAVPSPP EPNTSPPVRT KAMRCTARVP LAPADNGCCP  180
PPDGAEAVET APAAEVQQDY CSPDGGDLSI DLDFDMGDLY FLSPWRGEAG DAVVGADDQL  240
VVGEADLETL LLGPAGNDDV EFAWF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2329734128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886192e-80D88619.1 Oryza sativa mRNA for OSMYB3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465146.13e-81hypothetical protein SORBIDRAFT_01g032770
RefseqXP_004986909.12e-81PREDICTED: myb-related protein 308-like
TrEMBLC5WWN53e-81C5WWN5_SORBI; Putative uncharacterized protein Sb01g032770
TrEMBLK4AJ412e-81K4AJ41_SETIT; Uncharacterized protein
STRINGSi038905m5e-81(Setaria italica)
STRINGSb01g032770.19e-81(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.19e-53myb domain protein 5